PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G44140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 205aa    MW: 22647.9 Da    PI: 8.123
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G44140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS161.28.7e-5055199186333
             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       ++l++++L v+ +Ea+a+n+vl+lh++++es    +   +vL+++++lsP+ +v+veq+a hn++ Fl rf+eal+yy+alfd+l+a lpr +
  ORUFI01G44140.1  55 SSSLHIDDLGVDADEAVAINSVLELHSVVKESRGALN---SVLQTIRKLSPRAFVLVEQDAGHNGPFFLGRFMEALHYYAALFDALDAALPRYD 145
                      567899***********************88877777...8***************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                        r+ vE++ +g ei+nvv cega+r+erhe++ +Wr+r+++aGF++vp++  a
  ORUFI01G44140.1 146 ARRARVEQFHFGAEIRNVVGCEGAARVERHERADQWRRRMSRAGFQSVPIKMAA 199
                      *************************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.2641205IPR005202Transcription factor GRAS
PfamPF035143.0E-4755199IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAWHRALCFP PITHSLCSAT QTPAVALGGE PMRPLGIWAA ILTYQGIWAS NEAGSSSLHI  60
DDLGVDADEA VAINSVLELH SVVKESRGAL NSVLQTIRKL SPRAFVLVEQ DAGHNGPFFL  120
GRFMEALHYY AALFDALDAA LPRYDARRAR VEQFHFGAEI RNVVGCEGAA RVERHERADQ  180
WRRRMSRAGF QSVPIKMAAK ARELI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2358202190335GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008676175.15e-93PREDICTED: DELLA protein GAI1-like
TrEMBLA0A0E0N6E11e-150A0A0E0N6E1_ORYRU; Uncharacterized protein
STRINGGRMZM2G013016_P012e-92(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56403354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.16e-23GRAS family protein